PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G033400.1
Common NamePHAVU_004G033400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 89aa    MW: 9602.79 Da    PI: 8.5036
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G033400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.6e-321975360
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                        +v+Y eC+kNhAa++Gg+avDGC+Efm+s g egt+aal+CaACgCHRnFH+r+ve+e
  Phvul.004G033400.1 19 SVKYGECQKNHAANVGGYAVDGCREFMAS-GGEGTTAALTCAACGCHRNFHKRQVETE 75
                        699*************************9.8889*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-181985IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-302072IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.8E-262171IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3622271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MRKRQVVVRR EEPQRNVRSV KYGECQKNHA ANVGGYAVDG CREFMASGGE GTTAALTCAA  60
CGCHRNFHKR QVETEVVCEC SSPPSNGT*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-131AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151284.12e-59hypothetical protein PHAVU_004G033400g
SwissprotQ9LJW54e-42MIF2_ARATH; Mini zinc finger protein 2
TrEMBLV7C1P42e-59V7C1P4_PHAVU; Uncharacterized protein
STRINGGLYMA13G05380.22e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-26mini zinc finger 2